PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_CB0F2D278.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 247aa    MW: 27368.6 Da    PI: 10.4038
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_CB0F2D278.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.61e-1154112563
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l+ l+   + l+se+
  Traes_5AL_CB0F2D278.1  54 KRAKRIWANRQSAARSKERKMRYIGELERKVQTLQTEATTLSAQLSLLQRDTSGLTSEN 112
                            9************************************************9999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-1650114IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.72652115IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-1154109No hitNo description
SuperFamilySSF579599.85E-1254108No hitNo description
PfamPF001703.1E-1054112IPR004827Basic-leucine zipper domain
CDDcd147036.86E-2155104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MRPKHQHSQS MDESMSIKAE DLVGAPGMEG MSTVEAKKAV SAAKLAELAL VDPKRAKRIW  60
ANRQSAARSK ERKMRYIGEL ERKVQTLQTE ATTLSAQLSL LQRDTSGLTS ENGELKIRLQ  120
NMEQQVHLQD ALNDTLKTEV QRLKVATGQT GNGGGMLMNY GGMSQAPHQF GSNQQMFHNN  180
QSMQSLLATH QLQQLQLHPQ PXXXXXXXXX XQPLHLLQAQ QFQQAARDLK MKGPMWGDGK  240
SSGSGGI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3564330.0AK356433.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1034M13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015696550.11e-117PREDICTED: transcription factor RF2a
SwissprotQ69IL41e-101RF2A_ORYSJ; Transcription factor RF2a
TrEMBLW5F1F51e-171W5F1F5_WHEAT; Uncharacterized protein
STRINGMLOC_64781.31e-127(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.17e-79bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]